PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010927216.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 318aa    MW: 35243.9 Da    PI: 9.1712
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010927216.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.79.2e-57101371128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+ +yL++k+++ ++++ ++i+evd++k+ePwdLp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++s+
  XP_010927216.1  10 LPPGFRFHPTDEELIAYYLTQKISEANFSA-RAITEVDLNKCEPWDLPAKAKMGEKEWYFFSLRDRKYPTGVRTNRATNAGYWKTTGKDKEIFSS 103
                     79**************************99.89***************99999****************************************98 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++el g+kktLvfykgrap+gekt+Wvmheyrl
  XP_010927216.1 104 qTSELLGMKKTLVFYKGRAPRGEKTNWVMHEYRL 137
                     67788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.05E-637159IPR003441NAC domain
PROSITE profilePS5100561.42110159IPR003441NAC domain
PfamPF023655.8E-2911137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEGGAKEEQL PPGFRFHPTD EELIAYYLTQ KISEANFSAR AITEVDLNKC EPWDLPAKAK  60
MGEKEWYFFS LRDRKYPTGV RTNRATNAGY WKTTGKDKEI FSSQTSELLG MKKTLVFYKG  120
RAPRGEKTNW VMHEYRLQSK SAVKANKQDE WVVCRVFAKS PGGKKYPSSQ PRVNPYHHHH  180
HHHHLDMMTV PPDYGAHARS YLMAGADLAE LSRFARGTAP GSGPGPNLLP IQPPAPRAAP  240
PFTLSGLNLN LGGPSPVPAL SHQSLPLSSL LTNNSNCVMA TDGGFNADVV VSCTGAGGSY  300
HQQMDPSVVF DQVYWPPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-561016517171NAC domain-containing protein 19
4dul_A2e-561016517171NAC domain-containing protein 19
1ut7_B2e-561016517171NO APICAL MERISTEM PROTEIN
1ut7_A2e-561016517171NO APICAL MERISTEM PROTEIN
1ut4_B2e-561016517171NO APICAL MERISTEM PROTEIN
1ut4_A2e-561016517171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927216.10.0PREDICTED: NAC domain-containing protein 100-like
TrEMBLM0TJ051e-125M0TJ05_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P19680_0011e-125(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP93613846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.28e-96NAC domain containing protein 38